EDInfo Biomedical Sciences Maciver Lab. Home ABP  A-Z Encyclopaedia Amoebae Protist Links Cytoskeleton Links Site Index

Actin Binding Motifs

Small regions of actin binding proteins that have been determined to constitute an actin binding site (Table 1).

 

Actin Binding Protein Sequence(s) References
Actobindin LKAET  
ABP120 VGIGAEELVDKNLKMTLGMIWTIILR Bresnick et al, 1990, 1991
Annexin VLIRIMVSR Jones et al, 1992
Aldolase ADESTGSIAKRLQSIGTENTE O'Reilly & Clarke, 1993
ADF/Cofilin DAIKKK
WAPECAPLKSKM
Yonezawa et al, 1989
Yonezawa et al, 1991
CapZ (Dictyostelium b subunit) NQKYKQLQRELSQVL Hug et al, 1992
Caldesmon NLKGAANAEAGSEKLKEKQQEAAVE Wang et al, 1991
Calponin AEKQQRRFQPEKLREGRNIIGLQMGTNKFASQQGMTAY Mezgueldi et al, 1992
CEACAM1 FLHFGKTGSSGPLQ Schumann et al, 2001
MARKS KRFSFKKSKLSGFSFKKN Hartwig et al, 1992
Myosin II head IRICRKG
YRGKKQ
EGGGGKKGGKKKGSSF
Vandekerckhove & Vancompernolle, 1992
Myosin II light chain kinase DFRxxL Smith et al, 1999
Profilin GTAANVVEKLADYLIGQGF Vandekerkhove et al, 1989
Villin ("Head piece") PAAFSALPRWKQQNLKKEKGLF Friederich et al, 1992
Misc ABPs I/LWEQ  McCann & Craig, 1997
Table 1 Actin-Binding Motifs (adapted from Maciver, 1995)
References:-

Bresnick, A., Warren, V. & Condeelis, J. (1990) Identification of a short sequence essential for actin binding by Dictyostelium ABP-120, J. Biol. Chem. 265, 9236-9240.

Bresnick, A. R., Janmey, P. A. & Condeelis, J. (1991) Evidence that a 27-residue sequence is the actin-binding site of ABP-120, J. Biol. Chem. 266, 12989-12993.

Jones, P. G., Moore, G. J. & Waisman, D. M. (1992) A nonapeptide to the putative F-actin binding site of annexin-II tetramer inhibits its calcium-dependent activation of actin filament bundling. J.Biol.Chem. 267, 13993-13997.

Maciver, S. K. (1995) Microfilament organization and actin-binding proteins in The Cytoskeleton (Pryme, H., ed), JAI press inc., Greewich CT, London UK.

McCann, R. O. & Craig, S. W. (1997) The I/LWEQ module: a conserved sequence that signifies F-actin binding in functionally diverse proteins from yeast to mammals., PNAS. 94, 5679-5684.

Schumann, D., Chen, C.-J., Kaplan, B. & Shively, J. E. (2001) Carcinoembryonic antigen cell adhesion molecule 1 directly associates with cytoskeleton proteins actin and tropomyosin., J.Biol.Chem. 276, 47421-47433.

Smith, L., Su, X., Lin, P.-j., Zhi, G. & Stull, J. T. (1999) Identification of a novel actin binding motif in smooth muscle mysoin light chain kinase., J.Biol.Chem. 274, 29433-29438.

 
  EDInfo Biomedical Sciences Cytoskeletal Links Encyclopaedia of A.B.P.s The Amoebae Protozoology links Glossary of Amoeba terms   Maciver Lab Home